Independent · non-commercial · publishes on a quarterly cycle|Current cycle 2026 Q3
Compound Evidence InstituteEvidence synthesis · established 2023Graded assessments of compounds, trials, methods and supply
Document set current to 30 July 2026
Compound monograph · Incretin receptor agonists

Lixisenatide — compound monograph

GLP-1 receptor agonist (exendin-based, short-acting). Approved. The Institute assesses 3 outcomes for this compound and grades the strongest at moderate certainty.

Document identifier
CEI-MN-010
Series
Compound monograph
Version
3.1
Published
12 Oct 2024
Last reviewed
12 Apr 2025
Next review
12 Apr 2027
Identifier
10.71829/cei.mono.10
Certainty
Moderate
Cycle
2024 Q4

§1Identification and status

§1.1Nomenclature

Preferred name
Lixisenatide
Compound class
GLP-1 receptor agonist (exendin-based, short-acting)
Assessment series
Incretin receptor agonists
Synonyms and codes
AVE0010 · ZP10 · lixisenatide (INN) · Adlyxin (trade) · Lyxumia (trade)
Route as evaluated
Subcutaneous once daily before the first meal of the day

§1.2Chemistry

Chemical identifiers are reproduced where they are public. Where a structure has not been published the monograph records not disclosed rather than constructing one.[1]

CAS registry number
320367-13-3
Molecular formula
C215H347N61O65S
Average mass
4858.49
Monoisotopic mass
4856.30
ATC classification
A10BJ03

§1.3Sequence and structural notes

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH₂

A 44-residue exendin-4 derivative in which the C-terminal proline is deleted and six lysine residues are appended. The polylysine tail raises the isoelectric point and alters pharmacokinetics, producing a short-acting agent with a pronounced prandial profile.

§1.4Assessment status

The Institute assesses Lixisenatide across 3 indications and grades the strongest of them at moderate certainty. Holds a marketing authorisation for at least one indication in at least one jurisdiction.

Distribution of certainty ratingsShare of assessed outcomes at each certainty level.3assessed outcomes
HighModerateLowVery low
Figure 1. Distribution of certainty ratings across the 3 outcomes the Institute assesses for Lixisenatide. A rating attaches to a specific population, comparator and outcome and does not transfer between them.

Table 1. Assessed outcomes for Lixisenatide, ordered by certainty. Each row links to the per-indication evidence extract.

IndicationEffect as recordedCertaintyTrials
Atherosclerotic cardiovascular disease and cardiovascular risk reductionMACE hazard ratio 1.02 — neutralHigh1
Type 2 diabetes mellitus−0.7 to −0.9 % HbA1c at 24 weeks with pronounced postprandial glucose reductionHigh3
Obesity and overweight in adults−1.8 to −2.7 kgModerate1
Effects are reproduced as the contributing trials reported them. Where a confidence interval is held it appears on the per-indication extract rather than in this summary table.

References cited on this page

References are numbered in order of first citation in this document. Each superscript in the text links to its entry below.

  1. International Council for Harmonisation of Technical Requirements for Pharmaceuticals for Human Use. ICH Q6B Specifications: Test Procedures and Acceptance Criteria for Biotechnological/Biological Products. ICH Harmonised Tripartite Guideline 1999;Step 4 version. identifier not held by the Institute

Identifiers are reproduced only where the Institute holds them. Where a digital object identifier or PubMed identifier is not shown, the Institute has recorded the journal and year and has not constructed an identifier.

Nothing published by the Institute is medical advice, a diagnosis, a prescription, a treatment recommendation or a purchasing recommendation. Compounds supplied for research use are not approved for human or veterinary use in any jurisdiction, and a favourable analytical assessment of a supplier is not a statement that any product is safe or effective. The Institute publishes certainty ratings and never recommendations. No telephone number, messaging handle or ordering channel appears anywhere on this site.