Independent · non-commercial · publishes on a quarterly cycle|Current cycle 2026 Q3
Compound Evidence InstituteEvidence synthesis · established 2023Graded assessments of compounds, trials, methods and supply
Document set current to 30 July 2026
Compound monograph · Amylin analogues

Pramlintide — compound monograph

Amylin analogue, short-acting. Approved. The Institute assesses 3 outcomes for this compound and grades the strongest at moderate certainty.

Document identifier
CEI-MN-019
Series
Compound monograph
Version
1.3
Published
15 Jul 2026
Last reviewed
15 Jul 2026
Next review
15 Jul 2028
Identifier
10.71829/cei.mono.19
Certainty
Moderate
Cycle
2026 Q3

§1Identification and status

§1.1Nomenclature

Preferred name
Pramlintide
Compound class
Amylin analogue, short-acting
Assessment series
Amylin analogues
Synonyms and codes
AC137 · tripro-amylin · pramlintide (INN) · Symlin (trade)
Route as evaluated
Subcutaneous immediately before major meals

§1.2Chemistry

Chemical identifiers are reproduced where they are public. Where a structure has not been published the monograph records not disclosed rather than constructing one.[1]

CAS registry number
151126-32-8
Molecular formula
C171H267N51O53S2
Average mass
3949.44
Monoisotopic mass
3947.24
ATC classification
A10BX05

§1.3Sequence and structural notes

H-KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH₂

A 37-residue analogue of human amylin in which proline replaces alanine at position 25, serine at position 28 and serine at position 29. These three proline substitutions abolish the amyloidogenic self-assembly of native amylin while preserving receptor activity. An intramolecular disulfide bridge links Cys2 and Cys7.

§1.4Assessment status

The Institute assesses Pramlintide across 3 indications and grades the strongest of them at moderate certainty. Holds a marketing authorisation for at least one indication in at least one jurisdiction.

Distribution of certainty ratingsShare of assessed outcomes at each certainty level.3assessed outcomes
HighModerateLowVery low
Figure 1. Distribution of certainty ratings across the 3 outcomes the Institute assesses for Pramlintide. A rating attaches to a specific population, comparator and outcome and does not transfer between them.

Table 1. Assessed outcomes for Pramlintide, ordered by certainty. Each row links to the per-indication evidence extract.

IndicationEffect as recordedCertaintyTrials
Adjunctive therapy in type 1 diabetesHbA1c reduction of approximately 0.3 % with weight reduction of 1.4 kg and reduced insulin requirementModerate1
Type 2 diabetes mellitusHbA1c −0.62 % versus −0.18 % with placebo at 52 weeks, with weight −1.4 kgModerate1
Obesity and overweight in adults−3.7 kg at 16 weeks versus placebo in a non-diabetic obesity studyLow1
Effects are reproduced as the contributing trials reported them. Where a confidence interval is held it appears on the per-indication extract rather than in this summary table.

References cited on this page

References are numbered in order of first citation in this document. Each superscript in the text links to its entry below.

  1. International Council for Harmonisation of Technical Requirements for Pharmaceuticals for Human Use. ICH Q6B Specifications: Test Procedures and Acceptance Criteria for Biotechnological/Biological Products. ICH Harmonised Tripartite Guideline 1999;Step 4 version. identifier not held by the Institute

Identifiers are reproduced only where the Institute holds them. Where a digital object identifier or PubMed identifier is not shown, the Institute has recorded the journal and year and has not constructed an identifier.

Nothing published by the Institute is medical advice, a diagnosis, a prescription, a treatment recommendation or a purchasing recommendation. Compounds supplied for research use are not approved for human or veterinary use in any jurisdiction, and a favourable analytical assessment of a supplier is not a statement that any product is safe or effective. The Institute publishes certainty ratings and never recommendations. No telephone number, messaging handle or ordering channel appears anywhere on this site.